PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa017596
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family BBR-BPC
Protein Properties Length: 301aa    MW: 34387.7 Da    PI: 9.3325
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58685202PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-51892PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind299.99.7e-92930126301
  GAGA_bind  26 lqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsave 125
                +  m+++aerda+i+ernlal e+k a+aerdma lqrd+alaern a+ +rd+++++l ++ ++ ++++ + +++l++ + ++  ++   +q  ++ +e
  Lsa017596   9 KTFMAIMAERDAAIQERNLALDERKRAFAERDMAMLQRDAALAERNSAMQQRDEAIATLRFQGTNNNNNNNFIISTLPENTPTQGQNRNFTNQEIHHMFE 108
                4589*************************************************************99999999999999999887777545555566666 PP

  GAGA_bind 126 lreeeklealpieeaaeeakekkkkkkrqrakkpkekkak.kkkkksekskkkvkkesader.................skaekksidlvlngvslDest 207
                +++ ++ +++  +++++++k k+ + +r+r+++ k ++++ ++  +  +++ +v+++s +++                 + +e+k  +  ln+vs+D+ t
  Lsa017596 109 IPNDNTYQVQVQVQSTTKSKSKSPRVRRRRGESVKFTNQEiHHMLEIGEDTYEVEPQSYKTKgvkspmigrrrgesvklKVEEWK-DESELNQVSFDDLT 207
                666665554444444444444444444556666666555533333344455566666655447889999999***9994444555.5779********** PP

  GAGA_bind 208 lPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                +PvPvCsCtG+++ CY+WG+GGWqSaCCttt+S+yPLP++++++ +R++grKmS+gaf+klL +L++eGydls+p+DLk+hWAkHGtn++ t++
  Lsa017596 208 MPVPVCSCTGVPQPCYRWGSGGWQSACCTTTMSMYPLPQVSNKKYSRVGGRKMSGGAFSKLLTRLSSEGYDLSTPLDLKEHWAKHGTNRYSTVK 301
                ********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012267.3E-911301IPR010409GAGA-binding transcriptional activator
PfamPF062171.1E-809301IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MDHNHLTIKT FMAIMAERDA AIQERNLALD ERKRAFAERD MAMLQRDAAL AERNSAMQQR  60
DEAIATLRFQ GTNNNNNNNF IISTLPENTP TQGQNRNFTN QEIHHMFEIP NDNTYQVQVQ  120
VQSTTKSKSK SPRVRRRRGE SVKFTNQEIH HMLEIGEDTY EVEPQSYKTK GVKSPMIGRR  180
RGESVKLKVE EWKDESELNQ VSFDDLTMPV PVCSCTGVPQ PCYRWGSGGW QSACCTTTMS  240
MYPLPQVSNK KYSRVGGRKM SGGAFSKLLT RLSSEGYDLS TPLDLKEHWA KHGTNRYSTV  300
K
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016515335.11e-115PREDICTED: barley B recombinant-like protein D
TrEMBLH1ZN681e-128H1ZN68_ARTAN; GAGA-binding transcriptional activator
STRINGSolyc02g084230.1.11e-102(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38910.12e-69basic pentacysteine 5